Protein Info for LRK53_RS05480 in Rhodanobacter sp000427505 FW510-R12

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 84 to 110 (27 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 347 to 373 (27 residues), see Phobius details amino acids 385 to 402 (18 residues), see Phobius details amino acids 408 to 425 (18 residues), see Phobius details PF13520: AA_permease_2" amino acids 7 to 400 (394 residues), 169.8 bits, see alignment E=9.7e-54 PF00324: AA_permease" amino acids 16 to 399 (384 residues), 118.9 bits, see alignment E=2.6e-38

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>LRK53_RS05480 amino acid permease (Rhodanobacter sp000427505 FW510-R12)
MRNGNTIGFWTCTALVVGNVIGMGIFVLPASLAPFGFNALIGWIIVLAGCLVLARVFSHL
ARAMPDAEGPYGYIRRTLGELPAYLALWAYWVSLWLTNAALATGVVGYMAVVFPPLGALQ
PALFALGLLWAVVAINLFGVRTGGGVQIVTTALKLLPMLAIALLGGWLLLTSPASYTAHL
PTTPITLGGVTAAATIALFAMLGIESASVPAARVDDPARTIPRSTMTGTVLAAVIYIIVS
TVPLLLIHQTELAEASAPFALLMDRFAAAGSGRWLALFVVISGLGALNGWTLLGGELTCT
MAHNGVLPAMLARNNRHGAPAVALLLTGALASVMIAMSYSKSLVAAFTFLTRVVTAANLP
LYLCCALALIVLWRRRSATCATWRALLAGVTCVLFVVFAFIGIGHEPFLYALGLIAAGLP
LYALMRLRRRAAPSTEVIPE