Protein Info for LRK53_RS05440 in Rhodanobacter sp000427505 FW510-R12

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 2 to 321 (320 residues), 346.3 bits, E=7e-108
• PF00586: AIRS
  • amino acids 25 to 135 (111 residues), 101 bits, E=5.3e-33
• PF02769: AIRS_C
  • amino acids 147 to 304 (158 residues), 50.6 bits, E=2.5e-17

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 48% identity to she:Shewmr4_1101)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Protein Sequence (322 amino acids)

>LRK53_RS05440 thiamine-phosphate kinase (Rhodanobacter sp000427505 FW510-R12)
MEFDLIELIRQHTAQARDDVRLGIGDDAAVLAVPAGKELAVAIDTLVEGVHFPRGTAPMD
IGWKALAVNLSDLAAMGASPAWALLALTMPSADTAFVEGLAEGFARLAQPHRLALVGGDT
TRGPLTISVAVHGFVPPGQALTRAGARAGDVVLVTGTLGDAAAGLHGVQHPPRDDDNRAG
LRAFLGERLNRPTPRLAAGAALRGQATACIDISDGLLADLGHICTASGVGAEIEAAWLPR
SLALLELYDETTALHFALSGGDDYELCFTAPAARVAELQAGLARLGCGATKIGRILEGEG
VRVRAADGSWLATDRPGWEHFA