Protein Info for LRK53_RS05390 in Rhodanobacter sp000427505 FW510-R12

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 10 to 386 (377 residues), 575.2 bits, E=5.7e-177
• PF00155: Aminotran_1_2
  • amino acids 65 to 366 (302 residues), 33.1 bits, E=3.8e-12

Best Hits

Swiss-Prot: 84% identical to GLYA_STRM5: Serine hydroxymethyltransferase (glyA) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 84% identity to smt:Smal_0573)

MetaCyc: 71% identical to serine hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
4.1.2.-; Glycine hydroxymethyltransferase. [EC: 2.1.2.1]; RXN-6321 [EC: 2.1.2.1]; RXN0-5240 [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• glycine degradation (3/3 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• glycine betaine degradation III (4/7 steps found)
• folate transformations I (8/13 steps found)
• glycine betaine degradation I (4/8 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• photorespiration I (4/9 steps found)
• photorespiration III (4/9 steps found)
• photorespiration II (4/10 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• purine nucleobases degradation II (anaerobic) (9/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.1

Protein Sequence (417 amino acids)

>LRK53_RS05390 serine hydroxymethyltransferase (Rhodanobacter sp000427505 FW510-R12)
MFPKNCTIAGYDDELAKAIADEGQRQEDHVELIASENYASPRVMEAQGSKLTNKYAEGYP
GKRYYGGCEYVDVAERLAIERLKQLFDCDYANVQPHSGSQANQAVYLALLQPGDTILGMS
LAHGGHLTHGAKVNISGKLFHAVQYGVDENGLIDYDELQRLATEHQPKMLVGGFSAYSQV
IDWARMRRIADSVGALFFVDMAHVAGLVAAGVYPSPLPHAHVVTSTTHKTMRGPRGGFIV
AKGAGEEIEKKLQSIVFPGIQGGPLMHVIAAKAVAFKEALEPAFKEYQTQVVKNAKAMAK
TFIERGYKIVSGGTENHLMLVDMIGKPITGKDAEAALGKAHITVNKNAVPNDPQKPFVTS
GLRVGTPAATTRGYKEADCVELAGWICDVLDAPTDAAVITRVREAVTAQCKKYPVYG