Protein Info for LRK53_RS05130 in Rhodanobacter sp000427505 FW510-R12

Annotation: Holliday junction branch migration DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF05496: RuvB_N" amino acids 22 to 180 (159 residues), 272.4 bits, see alignment E=3.3e-85 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 25 to 328 (304 residues), 468.8 bits, see alignment E=3.2e-145 PF07728: AAA_5" amino acids 56 to 174 (119 residues), 22.3 bits, see alignment E=3.4e-08 PF00004: AAA" amino acids 57 to 180 (124 residues), 73.5 bits, see alignment E=6.8e-24 PF17864: AAA_lid_4" amino acids 183 to 256 (74 residues), 106.3 bits, see alignment E=1.6e-34 PF05491: WHD_RuvB" amino acids 258 to 327 (70 residues), 82.5 bits, see alignment E=4.9e-27

Best Hits

Swiss-Prot: 76% identical to RUVB_XANC8: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 80% identity to psu:Psesu_0593)

MetaCyc: 67% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>LRK53_RS05130 Holliday junction branch migration DNA helicase RuvB (Rhodanobacter sp000427505 FW510-R12)
MTDHRIITAAAQLDDEALEATIRPKRLAEYLGQQAVREQLSIYIEAAKKRGGALDHVLVF
GPPGLGKTTLSHVIANELGVNLRSTSGPVLERAGDLAALLTNLEANDVLFVDEIHRLSPL
VEEVLYPAMEDFQIDIMIGEGPAARSIKLDLPPFTLIGATTRAGMLTAPLRDRFGIVQRL
EFYTADELTAIVRRAARILGIVCAPEGAQEIARRSRGTPRIANRLLRRVRDYAEVRAGGE
ITLAAAQAALDMLKIDPQGFDELDRRLLGLIIENFGGGPVGVESLAAALSEDRGTLEDVV
EPYLIQQGYLVRTARGRMVSARGWRHLGLVPPPRQAQAADLFESGADDA