Protein Info for LRK53_RS05015 in Rhodanobacter sp000427505 FW510-R12

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00356: LacI" amino acids 15 to 58 (44 residues), 50.1 bits, see alignment 2.9e-17 PF00532: Peripla_BP_1" amino acids 90 to 324 (235 residues), 61.5 bits, see alignment E=1.4e-20 PF13377: Peripla_BP_3" amino acids 179 to 334 (156 residues), 96.1 bits, see alignment E=3.8e-31

Best Hits

KEGG orthology group: None (inferred from 41% identity to lch:Lcho_0392)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>LRK53_RS05015 LacI family DNA-binding transcriptional regulator (Rhodanobacter sp000427505 FW510-R12)
MSKKDARHHASGGLTMADLAELAGVSKITVSRALGNSLLVNPQTRERIQALAREHDYKLN
ISARNLRLRRSHTVAVIVEMKPSTDRTMFDPYPLVLLGGISQELTAAGYSVLLTTRQGAS
AAAVQAADGLILLGQGAHQDAVRRFDKLNLPMVVWGAQSASDAHVVVGSDNRLGGAVVAR
HFIALGRRRPVFIGNPSHPEIFERLNGFIDALALRGIKPLLMRRDEFTVDSGMDAVHSLH
QRKVGFDAIFACNDLVAMGAIRATLDLGRSVPADVSVVGYDDMPLGASFLPPLSSVRQDW
QEGGMLLARKVLALIEGEPASPESLPVSLIVRGT