Protein Info for LRK53_RS04990 in Rhodanobacter sp000427505 FW510-R12

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF00072: Response_reg" amino acids 6 to 114 (109 residues), 95 bits, see alignment E=9.5e-31 PF00158: Sigma54_activat" amino acids 140 to 306 (167 residues), 232.2 bits, see alignment E=8.8e-73 PF14532: Sigma54_activ_2" amino acids 141 to 311 (171 residues), 81.4 bits, see alignment E=2.4e-26 PF07728: AAA_5" amino acids 164 to 274 (111 residues), 24 bits, see alignment E=1e-08 PF25601: AAA_lid_14" amino acids 312 to 393 (82 residues), 76.2 bits, see alignment E=4.4e-25 PF02954: HTH_8" amino acids 421 to 459 (39 residues), 48.5 bits, see alignment 1.8e-16

Best Hits

Swiss-Prot: 39% identical to LUXO_VIBVU: Regulatory protein LuxO (luxO) from Vibrio vulnificus (strain CMCP6)

KEGG orthology group: K02667, two-component system, NtrC family, response regulator PilR (inferred from 66% identity to psu:Psesu_0553)

Predicted SEED Role

"Type IV fimbriae expression regulatory protein PilR" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>LRK53_RS04990 sigma-54 dependent transcriptional regulator (Rhodanobacter sp000427505 FW510-R12)
MNPQTVLVIDDERDIRELLTITLGRMDLQVDAVGTVAEARRALAERSYDLCFTDMRLPDG
TGHEIIELIAAEHPDMPVAMITAYGNVDAAVNALKAGAFDFVSKPVDIQMLRGLVRTALR
LAEERRSGAAAAKTGDSSRLIGDSSAMQQVRATIAKLARNQAPVYIAGESGVGKELVARL
IHEQGPRASGPFVPVNCGAIPSELMESEFFGHRKGSFTGASTDKEGLFQAAQGGTLFLDE
VAELPLHMQVKLLRAIQEKAVRPIGGRDEIPVDARILSATHKNLGQLVEQGQFRQDLFYR
INVIELRVPPLRERRGDVSQLSAFILKALAGKSGESVGQLSPSARGALEAYDFPGNVREL
ENILERAMAMCDGSTIEAADLMLPQRSARPSHEPAAPGQPSAPAAAASTGADGGLDDYIS
NLERTAIVKALEESRYNKTAAARKLGITFRALRYKLKKLGID