Protein Info for LRK53_RS04955 in Rhodanobacter sp000427505 FW510-R12

Annotation: L-fucose:H+ symporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 82 to 107 (26 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 288 to 305 (18 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 371 to 390 (20 residues), see Phobius details TIGR00885: L-fucose:H+ symporter permease" amino acids 1 to 391 (391 residues), 283.8 bits, see alignment E=2.7e-88 PF07690: MFS_1" amino acids 6 to 339 (334 residues), 92.5 bits, see alignment E=1.3e-30 TIGR01272: glucose/galactose transporter WARNING" amino acids 72 to 388 (317 residues), 333.7 bits, see alignment E=1.3e-103

Best Hits

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 74% identity to sml:Smlt2182)

Predicted SEED Role

"Predicted mannose transporter, GGP family" in subsystem Mannose Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>LRK53_RS04955 L-fucose:H+ symporter permease (Rhodanobacter sp000427505 FW510-R12)
MWGFLTSLNDILIPHLKSIFQLNYAQAMLVQFTFFGAYFLMALPAGQLVAALGYKKGIVA
GLAIAGVGALGFWPAAGLQLYPAFLAALFVLATGITVLQVAANPYVALLGPEKTSSSRLT
LAQALNSAGTALAPYFGGLLILSNVVKSPDELAVLEPAQRLLYDTQQAQAVQGPYIGLAV
VLFLLAAFVWLFRLPALSEATDKDDHARHGFAEVLRHPHVLFGVLGIFFYVGAEVSIGSF
MVNYLSMPEIGHLSEQQAAGYVSWYWGGAMVGRFVGSALMAKFSPRKLLALFAAINALLV
LTTISSSGALAMYSIIAIGLFNSIMFPTIFALSIERLGPMTSKASSLLIMAIVGGAIIPP
LQGVFADHIGLQHAFFLPLLCYLYIVFYGLRGSRIRSIPAADASEIH