Protein Info for LRK53_RS04950 in Rhodanobacter sp000427505 FW510-R12

Annotation: carbohydrate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 6 to 311 (306 residues), 176.3 bits, E=4.9e-56

Best Hits

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 55% identity to xcv:XCV1600)

Predicted SEED Role

"Fructokinase in mannoside utilization gene cluster (EC 2.7.1.4)" in subsystem Mannose Metabolism (EC 2.7.1.4)

MetaCyc Pathways

• heterolactic fermentation (16/18 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• D-sorbitol degradation I (2/3 steps found)
• D-mannose degradation II (1/2 steps found)
• mannitol degradation II (2/4 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• 1,5-anhydrofructose degradation (2/5 steps found)
• mannitol cycle (2/5 steps found)
• CMP-2-keto-3-deoxy-D-glycero-D-galacto-nononate biosynthesis (1/4 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)
• superpathway of CMP-sialic acids biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.4

Protein Sequence (326 amino acids)

>LRK53_RS04950 carbohydrate kinase (Rhodanobacter sp000427505 FW510-R12)
MPTRPILCFGEALIDLHADGLDPRGFAASFVPFAGGAPANVAVAAARLGGDARFAGMLST
DRFGDFLLDSLQQAGVGTADVVRTDAANSALAFVTLDAHGERSFAFYRERSADLLFRPAD
FRADAFRELAVFHVCSNSMTDPALAATTREGMQRAHGAGALVSFDLNLRPALWPAGSDPH
PLVWPALHLADVVKLSAEEFTWLAPDGEQAALDRLWQGRTRLVLVTDGAQPLRWFHPDAE
GELPGYTVAVVDATAAGDAFMGGLLCCLAELEAGPDRLDRLVAAMPRLHAMLRFAAACGA
LTVTRRGSFAAMPRGAEVLAFMEQQA