Protein Info for LRK53_RS04610 in Rhodanobacter sp000427505 FW510-R12

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00072: Response_reg" amino acids 5 to 117 (113 residues), 82 bits, see alignment E=3.6e-27 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 159 to 329 (171 residues), 139.1 bits, see alignment E=5.8e-45 PF00990: GGDEF" amino acids 162 to 324 (163 residues), 152.9 bits, see alignment E=6.4e-49

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>LRK53_RS04610 diguanylate cyclase (Rhodanobacter sp000427505 FW510-R12)
MLPKILVVDDTVANLVAMRRLLAGSGAELFEARSGNEALALCLDHEFALILLDVNMPDMD
GFEVAALLGSAERLRDTPIIFVTAAYADDMNRLKGYRSGAVDYIAKPINDTILQSKVRVF
LDLYTARMKLQQALDELAERNEQLTREIAERKLMETMVRHQAQHDPLTGLPNRILFQDRL
YGAIQRANRHHGSFALACIDLDGFKQVNDSHGHAAGDALLQEIAARLSTQLRSNDTVARL
GGDEFALLLEDIEDPRLALQLGEKLCAALSEPCALSVGGQPIEVRVGASIGIAPYRPDAA
DDADERLMQAADHAMYAAKRGGKGRCVLAD