Protein Info for LRK53_RS04545 in Rhodanobacter sp000427505 FW510-R12

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 229 to 253 (25 residues), see Phobius details amino acids 262 to 287 (26 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 2 to 173 (172 residues), 29.4 bits, see alignment E=8.2e-11 PF00535: Glycos_transf_2" amino acids 5 to 167 (163 residues), 101.8 bits, see alignment E=4e-33

Best Hits

Swiss-Prot: 50% identical to GTRB_BPSFX: Bactoprenol glucosyl transferase (gtrB) from Shigella phage SfX

KEGG orthology group: None (inferred from 62% identity to sml:Smlt3641)

MetaCyc: 50% identical to CPS-53 (KpLE1) prophage; bactoprenol glucosyl transferase (Escherichia coli K-12 substr. MG1655)
Phosphopolyprenol glucosyltransferase. [EC: 2.4.1.78]

Predicted SEED Role

"Glycosyltransferase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>LRK53_RS04545 glycosyltransferase family 2 protein (Rhodanobacter sp000427505 FW510-R12)
MPQLTVVVPAYNESAVLRSFHERLCKVLDGLPLACDVLYVDDGSHDDTWSIIESLVAADP
RTGALKLSRNFGKEAALTAGLDAVLADAAVVIDADLQDPPELIPALVEQWQAGYDVVYAT
RSAREGESGFKRLTAAAFYRSMERLSETAIPRDTGDFRLLSRRALDALQQLRERQRFMKG
LFSWIGYRQTAVHYQREPRQAGTTKWNYWRLGQLAIEGITSFSTAPLRLATWVGLAAAGV
SFAYGAFVLLKALLYGDPVRGYPTLILVVLFLGGVQLLALGVIGEYLGRNYAESKQRPLY
FIEERRPPRTPR