Protein Info for LRK53_RS04420 in Rhodanobacter sp000427505 FW510-R12

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF05368: NmrA" amino acids 8 to 200 (193 residues), 42.1 bits, see alignment E=3.8e-14 PF04321: RmlD_sub_bind" amino acids 9 to 129 (121 residues), 27.5 bits, see alignment E=7.3e-10 PF02719: Polysacc_synt_2" amino acids 10 to 284 (275 residues), 341.1 bits, see alignment E=2.4e-105 PF16363: GDP_Man_Dehyd" amino acids 11 to 292 (282 residues), 53.2 bits, see alignment E=1.5e-17 PF01073: 3Beta_HSD" amino acids 11 to 133 (123 residues), 64 bits, see alignment E=5.3e-21 PF01370: Epimerase" amino acids 11 to 223 (213 residues), 82.2 bits, see alignment E=1.8e-26 PF07993: NAD_binding_4" amino acids 12 to 131 (120 residues), 23 bits, see alignment E=1.8e-08 PF13460: NAD_binding_10" amino acids 14 to 131 (118 residues), 44 bits, see alignment E=1.1e-14 PF08485: Polysacc_syn_2C" amino acids 287 to 327 (41 residues), 68.4 bits, see alignment 1.6e-22

Best Hits

Swiss-Prot: 66% identical to CAPD_RICAH: UDP-glucose 4-epimerase (capD) from Rickettsia akari (strain Hartford)

KEGG orthology group: None (inferred from 73% identity to rpd:RPD_0748)

MetaCyc: 67% identical to UDP-N-acetylglucosamine 4,6-dehydratase (configuration-inverting) (Pseudomonas aeruginosa O11)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>LRK53_RS04420 polysaccharide biosynthesis protein (Rhodanobacter sp000427505 FW510-R12)
MESAFDGKTLLITGGTGSFGNAVLSRFLDTSIKEIRVFSRDEKKQDDMRVALQNDKVKFY
LGDVRDYGSIYDALKGVDYVFHAAALKQVPSCEFYPLEAVKTNVLGTENVINASIELGIS
RVVVLSTDKAVYPINAMGMSKALAEKIVVAKSRNCDPSQTVLCATRYGNVMASRGSVIPL
FVAQLLDGKPLTITDPNMTRFLMSLQDSVDLVLHAFDHAHPGDIFVQKSPASTVAMLAEA
LKQMLARDNEIRIIGTRHGEKLFETLVSREEMVRAEDRGRYYRIPADARDLNYKQYFEEG
ELEISTIDDYTSHNTERLDVEGIKRVVGQLGTLEKLRA