Protein Info for LRK53_RS04275 in Rhodanobacter sp000427505 FW510-R12

Annotation: co-chaperone DjlA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF05099: TerB" amino acids 55 to 166 (112 residues), 40.7 bits, see alignment E=2.7e-14 PF00226: DnaJ" amino acids 204 to 261 (58 residues), 47.5 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 33% identical to DJLA_HAEIN: Co-chaperone protein DjlA (djlA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K05801, DnaJ like chaperone protein (inferred from 38% identity to pay:PAU_00571)

Predicted SEED Role

"DnaJ-like protein DjlA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>LRK53_RS04275 co-chaperone DjlA (Rhodanobacter sp000427505 FW510-R12)
MSYTYTLWFAFFGLLIGHLPGAVTGAVIGFVFDNLRYSQRKHATPEAGGFIGPLFTLLGA
VAKSDGRVSEQEIAIAERLMTRMGLDAEQRRQAVASFNVGKQPEFDVTPTIAALRNWVGL
RRDHAFPVLDVVIETVLAEGNPPPEKMAILHQLAFALRISDMELMALMAMKGYAWNAGGS
RSHGQAYGTGGGYVPPQRAPQGPDPYAVLGIDRNADDRAIKRAYRKLISEHHPDRLGDLP
EDMRKRAEARASEINAAYDRIKEQRGFK