Protein Info for LRK53_RS04225 in Rhodanobacter sp000427505 FW510-R12

Annotation: DNA polymerase IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00817: IMS" amino acids 15 to 161 (147 residues), 183.5 bits, see alignment E=4.7e-58 PF11798: IMS_HHH" amino acids 178 to 204 (27 residues), 28.7 bits, see alignment (E = 2.1e-10) PF21999: IMS_HHH_1" amino acids 187 to 237 (51 residues), 46.5 bits, see alignment 8.5e-16 PF11799: IMS_C" amino acids 249 to 356 (108 residues), 71 bits, see alignment E=2.2e-23

Best Hits

Swiss-Prot: 68% identical to DPO4_STRM5: DNA polymerase IV (dinB) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 73% identity to psu:Psesu_2477)

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>LRK53_RS04225 DNA polymerase IV (Rhodanobacter sp000427505 FW510-R12)
MVVRVSASPRKILHVDMDAFYASVEQRDDPSLRGKPVAVAWRGARSVVCAASYEARVFGV
RSAMPAIRAERLCPQLIFVPPDFVRYKAVSRQIREIFARHTELIEPLSLDEAYLDVTTTK
SALGSATATAEAIRAAIREETRLTASAGVAPNKFLAKIASDFRKPDGLYVVRPQQVVAFL
TPLPVGRLPGVGKVMEAKLAVLGIATVGELRAFAPVELEQRFGRWGQRLHELSRGIDERP
VEPERPTLQVSAEDTFEHDLRLDQLEPHIRRLADKAWTAHLRERGRVARTVVLKLKTADF
HTLTRSLTPTLRPASATELADLACALRGRVERPADSLYRLVGVGLAGFVDADSYQAQTDL
FEVG