Protein Info for LRK53_RS04205 in Rhodanobacter sp000427505 FW510-R12

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 23 to 183 (161 residues), 98.3 bits, see alignment E=1.8e-32 PF04542: Sigma70_r2" amino acids 27 to 92 (66 residues), 46 bits, see alignment E=5.5e-16 PF08281: Sigma70_r4_2" amino acids 130 to 180 (51 residues), 59.3 bits, see alignment E=3.4e-20 PF04545: Sigma70_r4" amino acids 133 to 181 (49 residues), 39.3 bits, see alignment E=5.7e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>LRK53_RS04205 sigma-70 family RNA polymerase sigma factor (Rhodanobacter sp000427505 FW510-R12)
MDDIRSDPDRELVDAVLANRPGAFERLVREYQGLCWHIIQRMVRNPEDARELCQDTFLRV
HQCLHQYRGESALKSWIGRVAYTIALRHLQHKRIALVEPGADNDFALVENLGDGFDLEAA
CADAETARHLHAAIEALPPLQRTLLTLYYLEETTIPEIAQITGLASGTIKSHLFRSRLRL
RGALEARTGVAA