Protein Info for LRK53_RS04190 in Rhodanobacter sp000427505 FW510-R12

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 PF00364: Biotin_lipoyl" amino acids 6 to 77 (72 residues), 74 bits, see alignment E=2.2e-24 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 140 to 591 (452 residues), 495.4 bits, see alignment E=7.4e-153 PF07992: Pyr_redox_2" amino acids 140 to 460 (321 residues), 210.4 bits, see alignment E=1.2e-65 PF01134: GIDA" amino acids 141 to 202 (62 residues), 22.2 bits, see alignment E=2.1e-08 PF12831: FAD_oxidored" amino acids 141 to 179 (39 residues), 32.5 bits, see alignment 1.8e-11 PF00070: Pyr_redox" amino acids 310 to 380 (71 residues), 54.1 bits, see alignment E=5.5e-18 PF02852: Pyr_redox_dim" amino acids 479 to 587 (109 residues), 123.4 bits, see alignment E=1.5e-39

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 69% identity to xcc:XCC0544)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (604 amino acids)

>LRK53_RS04190 dihydrolipoyl dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MANTIEIKVPDIGGHDNVPVIEVLVKAGDTVAKEQSLITLESDKATMEIPSSAAGVVKEL
KLKVGDEVSEGAVIAVLEVAGASLPSPSGRGAGGEGTGEARSSAPTEPSPAPSGHPLPQG
EGKASQAASGTGRKADIECKLVVLGSGPGGYSAAFRAADLGVDTVLVERYGTLGGVCLNV
GCIPSKALLHAAAVIDEAEAMAAHGVTFGAPKIDIDKLRSFKSKVVGQLTGGLAGMAKAR
KVRTVEGSGTFVSPHEMEVQTKDGVKLLRFEHAIIAAGSQSVKLPAFPWDDERVMDSTGA
LELKDVPKNLLVVGGGIIGLEMATVYSALGSAVTVVEFMDQLIPGADADLIKPLAKRLGG
KLKGVHLKTKVVSAKATKKGIEVGYEGDSIPETTLFDRVLVAVGRSPNGNKIGADKAGVA
VTERGFINVDTQMRTNVPHIYAIGDLVGQPMLAHKATHEAHVAAQAVAGQKSHFDARVIP
SVAFTDPEIAWVGVTEREAKEKGLKVGVGKFPWAASGRAIGIDRTEGFTKLIFDEATHSI
VGAGIVGVHAGDLISELALAIEMGSEAADIALTVHPHPTLGESVGMAAEIYEGTITDLYL
PKKK