Protein Info for LRK53_RS04170 in Rhodanobacter sp000427505 FW510-R12

Annotation: mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 101 to 128 (28 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 20 to 65 (46 residues), 31.8 bits, see alignment 2.2e-11 PF21088: MS_channel_1st" amino acids 74 to 113 (40 residues), 23.8 bits, see alignment 7.2e-09 PF00924: MS_channel_2nd" amino acids 115 to 181 (67 residues), 59.1 bits, see alignment E=7.4e-20 PF21082: MS_channel_3rd" amino acids 188 to 269 (82 residues), 38.7 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 39% identical to MSCS_ECOLI: Small-conductance mechanosensitive channel (mscS) from Escherichia coli (strain K12)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 44% identity to pca:Pcar_2469)

MetaCyc: 39% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>LRK53_RS04170 mechanosensitive ion channel (Rhodanobacter sp000427505 FW510-R12)
MFEISAAALARVAAMRDASAYTDQAMQLGLRLLGALLVLLVGMWVARRLANFARAALGRA
NLDSTLSGFLRNLIYGVLVVLLVVTALGVLGVPSAPMVAALGTAGLAVGLALQGSLSNLA
WGVLLVLFRPFRVGDYVSAGGTEGTVQSINLMHTQLLLPDNREAILPNAKVGGDAIINYN
RRGTRRFELKLGIAYRDDAEQVMAAIRQLMAADPRILKDPAPGVWIENLSGQTVNLVLRG
WTLVSDGWDAQTDLLHAIKRQIDAQQISIPVGPQQVTLVRGNPGPGGA