Protein Info for LRK53_RS04065 in Rhodanobacter sp000427505 FW510-R12

Annotation: flavohemoglobin expression-modulating QEGLA motif protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 337 to 353 (17 residues), see Phobius details PF08014: MATCAP" amino acids 55 to 413 (359 residues), 360.7 bits, see alignment E=4.4e-112

Best Hits

KEGG orthology group: None (inferred from 55% identity to psu:Psesu_2731)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>LRK53_RS04065 flavohemoglobin expression-modulating QEGLA motif protein (Rhodanobacter sp000427505 FW510-R12)
MSAADGAVAPQLQRYAALDQRLLAAVRGIRILPTVAWPASLEDRMIADYAGGRFALPQVS
YARPDLSAARAELAAIEAAAGGGDPADSDPLGDYLRRTAESWRIAAGMLESVGSAGVTAP
SIALYGRPDDTIPGSQRSNLDAARYFVELSDELGADLLADDSSVNMPADVLRSDLAATLD
EFFGAGTISVEVDPELTAKAAAGATRIRLRGGASFSAYDRHQLLAHEAFVHSLTALNGRR
QPLLASLARTSPRVTATQEGLAVFAELMSGAIDIARLKRISLRILAIDMALNGADFVEVY
KYFSACGQNAADSFHSAQRVFRGVPLGGGAAFAKDNVYLSGLLTVHTFFRWALRQRRMDL
LRHLFAGKLTLHDVVALQPHFESGAILPPRWLPPWMQHVHGLAGKLAFSVFVNGIHMSKV
QAGDLSLDV