Protein Info for LRK53_RS04030 in Rhodanobacter sp000427505 FW510-R12

Annotation: sulfotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 PF14559: TPR_19" amino acids 22 to 87 (66 residues), 25.8 bits, see alignment E=6.9e-09 amino acids 92 to 156 (65 residues), 26.1 bits, see alignment E=5.7e-09 PF13432: TPR_16" amino acids 22 to 80 (59 residues), 24.8 bits, see alignment 1.6e-08 amino acids 85 to 146 (62 residues), 41.9 bits, see alignment E=7.2e-14 amino acids 129 to 180 (52 residues), 25.9 bits, see alignment 7.1e-09 PF13181: TPR_8" amino acids 83 to 112 (30 residues), 12.5 bits, see alignment (E = 9.6e-05) amino acids 116 to 145 (30 residues), 17.7 bits, see alignment (E = 2e-06) PF13414: TPR_11" amino acids 92 to 122 (31 residues), 30.6 bits, see alignment (E = 1.4e-10) PF00685: Sulfotransfer_1" amino acids 287 to 473 (187 residues), 41.9 bits, see alignment E=5.3e-14 PF13469: Sulfotransfer_3" amino acids 288 to 473 (186 residues), 129.3 bits, see alignment E=1.8e-40

Best Hits

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>LRK53_RS04030 sulfotransferase (Rhodanobacter sp000427505 FW510-R12)
MSARLHGLTPDLTRAVSAVARALDDGRLDVATARMAPLLAGQPDHPEVQRLHAGILGMQG
RHQEAIALMRTALAGHPDDPIYLNTLATLLGQAGEYDGAIDALRAACRLQPDMALAWYNL
GVMLTRSVRNDEAEAALRRAVELDPHATDARALRADMLRMRGQPAEAAAEYRRVLTERAW
AGMAWWGLADLKTTRMGEADVAAMRAALREPRATDDDRIAIGFALARALDDQGQYAESLQ
AIATANTIARRRQQWNAAGYSAAIDALAAAFDPPPAGADEPGLGHEAIFIVGLPRSGSTL
AEQILASHPQVEGTGELPDLPQVLAEESRWRGQPFPRWVPHMQPADWSRLGHRYLERTAH
WRKHRPRFTDKLPSNWIYAEAIRAMLPGARIVGCRRDALETCFSCYRQRLDNNEYSRDFG
DLASFWRNCERSLQRLAARHPQAVLLHDYEALLAEPEARIRALLDFCGLPFDPACLSFHE
NTREVRSPSASQVRQPLRGDTAHSTRYGALLDPLRTALGQPPWQA