Protein Info for LRK53_RS03795 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphomethylpyrimidine synthase ThiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 PF13667: ThiC-associated" amino acids 20 to 87 (68 residues), 67.3 bits, see alignment E=8.9e-23 TIGR00190: phosphomethylpyrimidine synthase" amino acids 121 to 572 (452 residues), 670.1 bits, see alignment E=5.9e-206 PF01964: ThiC_Rad_SAM" amino acids 122 to 569 (448 residues), 600.4 bits, see alignment E=1.8e-184

Best Hits

Swiss-Prot: 72% identical to THIC_RHIEC: Phosphomethylpyrimidine synthase (thiC) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03147, thiamine biosynthesis protein ThiC (inferred from 75% identity to apt:APA01_25230)

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate synthase ThiC (EC 4.1.99.17)" (EC 4.1.99.17)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>LRK53_RS03795 phosphomethylpyrimidine synthase ThiC (Rhodanobacter sp000427505 FW510-R12)
MPTTTIHPPAAPADVTTGPIRGSRKVYLTPSGHPALRVPFRQVALTDPRQPTLNLYDTSG
PYTEDAAAIDLARGLPRVREAWLAARGFEAIGPESGGHADVGTPACPARPLRQRGRAGQA
VTQLEFARAGIVTEEMVYAAFRENLGRARALDDAAARRADGEDFGAAIPDFVSAEFVREE
IARGRAILPANINHPELEPMVIGRNFLVKINANIGNSAVSSGVAEEVEKLVWSIRWGADT
VMDLSTGRNIHAIRSWIMRNAPVPIGTVPIYQALEKVGGDPLKLNWEVFRDTLIEQAEQG
VDYVTIHAGVRLAYVPLTANRVTGIVSRGGSIMARWCLAGHRESFLYEHFAEICAICRAY
DVSLSLGDGLRPGSIADANDAAQFAELETLGELTRIAWVHGCQVMIEGPGHVPMHKIKAN
MDKQLALCGEAPFYTLGPLSTDVAPGYDHITSSIGAAMIGWFGTAMLCYVTPKEHLGLPD
RDDVKTGVIAYRIAAHAADLAKGHPAAKLHDDALSRARFEFRWEDQFNLALDPDTARAFH
DATLPKEAHKVAHFCSMCGPKFCSMKISQDLREDAAKLAGMAAKSEEFMAVGGALYVPVA