Protein Info for LRK53_RS03710 in Rhodanobacter sp000427505 FW510-R12

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 PF00270: DEAD" amino acids 33 to 205 (173 residues), 159.2 bits, see alignment E=1.2e-50 PF04851: ResIII" amino acids 52 to 201 (150 residues), 28.1 bits, see alignment E=2.7e-10 PF00271: Helicase_C" amino acids 243 to 351 (109 residues), 103 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 58% identical to RHLB_XANC5: ATP-dependent RNA helicase RhlB (rhlB) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K03732, ATP-dependent RNA helicase RhlB [EC: 3.6.4.13] (inferred from 60% identity to xal:XALc_2880)

Predicted SEED Role

"ATP-dependent RNA helicase RhlB" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>LRK53_RS03710 DEAD/DEAH box helicase (Rhodanobacter sp000427505 FW510-R12)
MSQTILTDTFFANFDLHPLLQQGLDDSGFTRCTPIQEMTLPPALAGRDVAGQAQTGTGKT
CAFLVALMNRLLTTPAVAERKDSDPRALIIAPTRELAIQIDKDARNIGRHTGLKTALIYG
GVDYDKQRQQLKDGCDIIIATPGRLLDYHKQGVFSLNGVEVMVIDEADRMFDLGFIKDVR
FIFRKLPPREQRQVLLFSATLSHRVLELAYEHMHEAEKLVVESDHVTADKVRQVVYFPAK
EEKMPLLLNLIDRHQPTRSIIFVNTKAAAERVTERVKRHGCRVGAISGDVPQLKRQKLLQ
RFQEGQLDILVATDVAARGLHIPHVSHVFNYDLPHEAEDYVHRIGRTARLGAEGDAISFA
CDLYAMSLPDIETYIGQSIPVAAMEPELLVMPRPHAIDPEFAANAAADSAAFGDVVAPRP
GEKPRRSGGQGRGAERHAGGRGVARPPREHRPAVAEGRTVAANELPPAVAVHRSEAAPAT
GGDPAPEGARKPRRRRGGRNRRREGAPTDGVETTGRQPAVAEGNRAPRGERRPPRERGTA
ESAGIGHSRPSRQVAVTSGKPAEHAHPAKPSLFRRLTRLFTRR