Protein Info for LRK53_RS03300 in Rhodanobacter sp000427505 FW510-R12

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 358 to 391 (34 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details amino acids 447 to 447 (1 residues), see Phobius details amino acids 449 to 464 (16 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 71 to 338 (268 residues), 79.3 bits, see alignment E=9e-26 PF00535: Glycos_transf_2" amino acids 74 to 121 (48 residues), 45.5 bits, see alignment 2e-15 amino acids 144 to 214 (71 residues), 41.4 bits, see alignment E=3.7e-14 PF13632: Glyco_trans_2_3" amino acids 179 to 401 (223 residues), 47.4 bits, see alignment E=5.5e-16

Best Hits

KEGG orthology group: None (inferred from 55% identity to swo:Swol_2439)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>LRK53_RS03300 glycosyltransferase family 2 protein (Rhodanobacter sp000427505 FW510-R12)
MNTYWSAVPALLQLGSWEHVLVSMQWIFMIYFVAINLAYLILNYISAYQIVRYMREYRAN
YLPPGLREYQPPVSIVLPAHNEEKSVVASVHSLLKTNYPEFEVVVVNDGSSDRTRHALIE
AFGLVKVPEAYRARLHTEQVEGVYASARYPHVRMVDKANGGKADAINAGINCVRYPLFCV
VDADCILQPESLSRVVRPFLEDRRVAATGGVVRVLNGCKVADGMLSRVGLPDRWLPSFQV
IEYLRAFLFGRMGWSPMNALLIISGAFGVFYKERVIAIGGYRDDTVGEDMDLVVRLHRNL
REEKRDYRIVFVPDPVCWTEVPTDVASLGNQRVRWQRGLAESLWSNIGLMFNRRGGVVGW
VAFPFMLLFEFLGPIIEVVGYVSMIVLALAGLVPLKVFLVFLAAAIGMGVLLSVNAMLLE
ELSFGLYARPVQQLRLFAVAVLENFGYRQMNSCWRFYGTLLWLFGLRKHHRWGHIRRDGS
WHHGQAENETMPIDQVSEGSKQA