Protein Info for LRK53_RS03160 in Rhodanobacter sp000427505 FW510-R12

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00191: homoserine kinase
  • amino acids 26 to 296 (271 residues), 172.2 bits, E=5.8e-55
• PF00288: GHMP_kinases_N
  • amino acids 81 to 167 (87 residues), 50.8 bits, E=1.7e-17
• PF08544: GHMP_kinases_C
  • amino acids 230 to 302 (73 residues), 50 bits, E=3.3e-17

Best Hits

Swiss-Prot: 70% identical to KHSE_XANCP: Homoserine kinase (thrB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 70% identity to psu:Psesu_1250)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (15/18 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-threonine biosynthesis (2/2 steps found)
• L-methionine biosynthesis II (4/6 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Protein Sequence (332 amino acids)

>LRK53_RS03160 homoserine kinase (Rhodanobacter sp000427505 FW510-R12)
MNTPLLEPVMAAPRRAHPPQAACAFAPASVGNVGVGFDLLGHSVAGAGDRAEVRRIGEPV
VRIASISGCVTELPTDPRANTAGTALLSLRKALGLRHGFELVLHKGIALGSGMGGSAASC
VAALIAANALLPKPLPREALYGFALDGEAVASGSRHGDNLGSMLLGGLVLATHDRLLRID
VPAAWHCALVHPHVVLETRRARAALAGHYALGEFVAQSSNLALVLAGCWRGDAALVREGL
KDVLVEPRRASLIPHFAQVKQAALDHRALGASISGAGPSVFGWYDNRADAEAAAAAMQAA
FAEGGLDSDAWVSPVNGPAAALIDSLDVESQP