Protein Info for LRK53_RS03090 in Rhodanobacter sp000427505 FW510-R12

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR00465: ketol-acid reductoisomerase" amino acids 9 to 322 (314 residues), 430.6 bits, see alignment E=1.5e-133 PF07991: KARI_N" amino acids 9 to 171 (163 residues), 239.7 bits, see alignment E=1.9e-75 PF01450: KARI_C" amino acids 178 to 321 (144 residues), 207.1 bits, see alignment E=2.2e-65

Best Hits

Swiss-Prot: 76% identical to ILVC_XANCB: Ketol-acid reductoisomerase (NADP(+)) (ilvC) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 76% identity to sml:Smlt3913)

MetaCyc: 57% identical to acetohydroxyacid isomeroreductase (Cupriavidus necator H16)
Ketol-acid reductoisomerase. [EC: 1.1.1.86]; 1.1.1.86 [EC: 1.1.1.86]

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>LRK53_RS03090 ketol-acid reductoisomerase (Rhodanobacter sp000427505 FW510-R12)
MSPQTSNPLASSRIAVLGYGSQGRAHALNLRDSGLDVVVGLRPNGPTWHKAKADGFKVAE
PADAVKGADLVAVLTPDMVQPALYKEAIEPNLKPGAALLFAHGFNVHFGQIKPRADVDVI
LVAPKGPGALVRSEYERGRGVPCIWAVHQDVSGQAEAKTKGYADGIGGGRAMIIQTDFKE
ETETDLFGEQAVLCGGASELVIKGFETLVEAGYQPEIAYYEVMHELKLIVDLFYEGGLAK
MLQFVSETAQYGDYVSGPRVVDAGTKARMKEVLHDIQDGTFAKNWIAEYQAGLPNYKRLK
QADLEHPIEVVGAKLRAQMPWLQPNPAPASAPLKKAG