Protein Info for LRK53_RS03045 in Rhodanobacter sp000427505 FW510-R12

Annotation: multicopper oxidase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 89 to 115 (27 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details PF07732: Cu-oxidase_3" amino acids 266 to 372 (107 residues), 42.8 bits, see alignment E=1.6e-14 PF07731: Cu-oxidase_2" amino acids 279 to 371 (93 residues), 29 bits, see alignment E=2.5e-10 amino acids 406 to 517 (112 residues), 21.7 bits, see alignment E=4.3e-08 PF00394: Cu-oxidase" amino acids 380 to 444 (65 residues), 23.2 bits, see alignment E=2e-08 PF13442: Cytochrome_CBB3" amino acids 553 to 635 (83 residues), 39.8 bits, see alignment E=1.4e-13 PF00034: Cytochrom_C" amino acids 555 to 636 (82 residues), 39.3 bits, see alignment E=4.1e-13

Best Hits

KEGG orthology group: K00368, nitrite reductase (NO-forming) [EC: 1.7.2.1] (inferred from 64% identity to gpb:HDN1F_11850)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.7.2.1

Use Curated BLAST to search for 1.7.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>LRK53_RS03045 multicopper oxidase domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MSVPDGGKPAPSTWPAVAGTALRVAFGLIWAVSAALTWTSDFANHYVGYLHNAATGQPAW
SAWWFDLWIGLVTPHVGFFVWATRIAETLLALALLLGFARKITYVVGILFSLLIWSTAEG
FGGPYSVGANNIGAAISYVLIFAALIVINLRAGPSPYSLDYLIERRWPGWRRVADWNDTL
PLAEVPRLPWRVQGPALAGVLILVALLLAGLHSALNVRSSSPQAAAAAVTPLSLASSQPI
EKARDASLPPLQPGDSVDVHITSSNDSVEIASGVQYQAWTFGKTVPGPVIHVRQGQTVNF
TLTNRGTMQHSIDFHSAITPPSLHYVDIMPGESITFSFVAKVPGAFLYHCGTPPVLLHIG
NGMYGAIIVDPATPLPPAQESYVLVQGEWYTQQVSGKLMAGNYEKMQAMQPDEVVFNGAA
FQYRDHPLTAKPGDRVRLYVVNAGPSLWSAFHVIGAIFDKVYPGGNPAQAIDGVSTYSVG
PGEGAVFDLKLDEAGHYPFVDHAMAHMQLGAQGVLLVGGPNETAAKPPVSKAPVAAAPAT
PPAAASGPYKFDPTRGTSLYATNCAACHQATGLGLPGAFPPLKDNVVVLDANPAKHIEVI
LKGLQGQVINGTSYPTAMPPFAAALNDADIADIANHERSSWGNQGKLITAEQVKDARGK