Protein Info for LRK53_RS02960 in Rhodanobacter sp000427505 FW510-R12

Annotation: RNA-binding transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 PF09371: Tex_N" amino acids 3 to 76 (74 residues), 100.4 bits, see alignment E=1.5e-32 PF22706: Tex_central_region" amino acids 131 to 307 (177 residues), 243.9 bits, see alignment E=4.3e-76 PF16921: Tex_YqgF" amino acids 323 to 449 (127 residues), 183.7 bits, see alignment E=6.9e-58 PF14635: HHH_7" amino acids 467 to 554 (88 residues), 37.1 bits, see alignment E=1.4e-12 PF12836: HHH_3" amino acids 489 to 553 (65 residues), 100.4 bits, see alignment E=1.9e-32 PF03934: T2SSK" amino acids 494 to 542 (49 residues), 25.3 bits, see alignment 6.5e-09 PF17674: HHH_9" amino acids 559 to 628 (70 residues), 84.4 bits, see alignment E=3.2e-27 PF00575: S1" amino acids 647 to 718 (72 residues), 64.8 bits, see alignment E=3e-21

Best Hits

Swiss-Prot: 62% identical to Y568_HAEIN: Uncharacterized protein HI_0568 (HI_0568) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06959, uncharacterized protein (inferred from 74% identity to psu:Psesu_2968)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (776 amino acids)

>LRK53_RS02960 RNA-binding transcriptional accessory protein (Rhodanobacter sp000427505 FW510-R12)
MLSIEQRIANDIAAKTEQVRAAVDLLDGGATVPFIARYRKEVTGGLDDTQLRLLEERLRY
LRELEERRAAILASVEEHGKLSDALKADLLAADTKARLEDLYLPFKPKRRTKAQIAREAG
LEPLALGLREDPTRTPEAFAEAFVDADKGVADARAALDGARAILMESIAEDAHLVGELRD
WLWAQGQIRAKVVAGKENEGAKFRDYFDHVEPIAKIPSHRLLALMRARNEGVIELELAPA
ADSEQGHAEGEGRVAAHADIHNRGRAADAWLRETVRLTWRVKLHLHLTLDLFGRVREGAE
DEAIRVFGDNLKDLMLAAPAGAKTVMGLDPGIRTGCKVAVVDATGKLLATDTIYPLEPRR
QWNESLVSLAKLCRQHGVDLIAIGNGTGSRETDKLAAELIRKLPEAKLSKVVVSEAGASV
YSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKAIGVGQYQHDVNQIKLARA
LDAKVEDCVNAVGVDVNTASAALLSRVAGLSASVAENVVKHRDANGPFANRKALLKVPRL
GDKAFEQCAGFLRVPNGDNPLDASAVHPEAYPVVERIIAQCGREVRNIIGDSAFLRGLKA
EQFTDEKFGVPTVRDILKELEKPGRDPRPAFVAPSFAEGVEDLKDLRPGMILEGRVTNVA
AFGAFVDIGVHQDGLVHVSALSHTFVKDPRDAVKAGDIVKVKVMEVDLPRQRIGLSMRLD
DEPGQARGGRAGAAGNDTRGGQRDNRGPRPGGGAPKPAPAPASNAFADAFARAGKR