Protein Info for LRK53_RS02925 in Rhodanobacter sp000427505 FW510-R12

Annotation: DNA-processing protein DprA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR00732: DNA protecting protein DprA" amino acids 72 to 289 (218 residues), 243.4 bits, see alignment E=7.5e-77 PF02481: DNA_processg_A" amino acids 77 to 280 (204 residues), 240.7 bits, see alignment E=9.6e-76 PF17782: DprA_WH" amino acids 324 to 382 (59 residues), 55.8 bits, see alignment E=3.8e-19

Best Hits

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>LRK53_RS02925 DNA-processing protein DprA (Rhodanobacter sp000427505 FW510-R12)
MSMDDPDELRAWLIALRTPGLGPGGLRERLDAAGGDIRAALAQLRRDAARLDELAQAWLA
RPNEARLDADLTWLAEPGHRLLRCTEADFPPQLEHIPQPPAVLFVVGDAGLLLYPQVAIV
GARGASAVGLTHARAFALALAEAGFAITSGMADGIDGAAHLAALDAGAKTLAVVGTGADR
VYPRKHHALARRLAAQGALVSEFPPGTPARPDHFPRRNRIIAGLALGTLVVEAGLRSGSL
ITARLAAEQGREVFALPGSIHHPLARGCHRLIRDGARLVETAAEIVETLTSAARMLGGEL
AARLDAAGGAAAGVSRIAGGDAASAPVGADGDPGYRWLLTELGHEPATLDELVQRTGQSA
AALSSMLLMLELEARVASLPGNRYQQLPGG