Protein Info for LRK53_RS02895 in Rhodanobacter sp000427505 FW510-R12

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 51 (17 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 177 to 194 (18 residues), see Phobius details amino acids 200 to 216 (17 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 363 to 387 (25 residues), see Phobius details amino acids 394 to 412 (19 residues), see Phobius details PF04932: Wzy_C" amino acids 182 to 342 (161 residues), 82 bits, see alignment E=2e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>LRK53_RS02895 O-antigen ligase family protein (Rhodanobacter sp000427505 FW510-R12)
MRAQPASWQLWTVSLLLAIMPLCFAVSGRFKILPMTLLFVVGVVLLATRAESRQAWRLAW
PVIAVCALRLLYDIGNFLGHRLDWSTLDLPAQTVLFLGIAAVFTLPVKQRVVAIGFSLTA
MLLGAASLYQRYALGVDRPYGLNGGDWAAVEFAMYLLVLVLLAMLQALRPGTSRGERWLH
IAAVVVGLYGAVLTQSRGPLLSFAPVYLGLMLWYAMRSRHWRRVLLLFAVTVIGMLAVTA
TLHREMVERLTAVPVQIASFGNGGSDGGATAVGERLEMWRTAWQAFREHPLAGIGLDQFG
VRVREQVAIGQASPLIAKYVHPHSEYLESMVAGGLPALLVLLLFLAVPLGFFARHLGHPQ
EPVAAAAAAGVMVIGMYVLCAFGDNVFYRAMPQSLYLFLVSGLAVSIGRLRCSVSSR