Protein Info for LRK53_RS02840 in Rhodanobacter sp000427505 FW510-R12

Annotation: dihydroneopterin aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR00526: FolB domain" amino acids 1 to 117 (117 residues), 102.8 bits, see alignment E=1.4e-33 TIGR00525: dihydroneopterin aldolase" amino acids 2 to 114 (113 residues), 81.5 bits, see alignment E=6.7e-27 PF02152: FolB" amino acids 4 to 113 (110 residues), 108.5 bits, see alignment E=1.3e-35

Best Hits

Swiss-Prot: 51% identical to FOLB_ECOL6: Dihydroneopterin aldolase (folB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 77% identity to psu:Psesu_0196)

MetaCyc: 51% identical to dihydroneopterin aldolase (Escherichia coli K-12 substr. MG1655)
RXN-10856 [EC: 5.1.99.8]; Dihydroneopterin aldolase. [EC: 5.1.99.8, 4.1.2.25]

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25 or 5.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>LRK53_RS02840 dihydroneopterin aldolase (Rhodanobacter sp000427505 FW510-R12)
MDTVFIEDLRIDAVIGVYEWERRVRQTLSFDIEMAFDNTVPAASDDIALTLNYKDVSKRL
IGYVEASSFGLVETLAERCTAIIREEFGVAWVRLKLSKPGAVRGAKAVGVCIERGTRR