Protein Info for LRK53_RS02790 in Rhodanobacter sp000427505 FW510-R12

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 899 transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details PF03924: CHASE" amino acids 130 to 268 (139 residues), 76 bits, see alignment E=7.1e-25 TIGR00229: PAS domain S-box protein" amino acids 353 to 468 (116 residues), 28 bits, see alignment E=2e-10 PF13188: PAS_8" amino acids 358 to 412 (55 residues), 25.4 bits, see alignment 2e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 470 to 634 (165 residues), 127.8 bits, see alignment E=3.5e-41 PF00990: GGDEF" amino acids 475 to 632 (158 residues), 130.8 bits, see alignment E=8.3e-42 PF00563: EAL" amino acids 654 to 891 (238 residues), 204.9 bits, see alignment E=2.6e-64

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (899 amino acids)

>LRK53_RS02790 EAL domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MNPLPRNKDYDEDQPTAANGRGEPDAAFPVPSPWRLTSWLWSLLALLSGLALTVFIHQQQ
QQRLQVERTLIRDELANKALASLQGRLHAAESLLRAAQSLFLSSEEVDEGEYTGFYANMS
PREQFPSLLALAYARRELRPDGEHYITRWVRPLAGNESVVGLDVATQPHNFASLLASRDS
DQATLSAPFHPVQLIGSGTAGEGITLRLPIYSSGSPPQSTAERRTRMRGSIAASFRLEGL
IGEALPERLARNLRLRVSDVSGSQVVLLFDSDTGPWWSGADYRYERRLAYGGRTWSVEVR
SLPQRAHRLIGGGRGILLAGVLGSVLLALLVYSVASTGQRALAQGWRMSHRYRESEKRFR
ALNDLLPALVLLAEAADGTITYANQAARDRLGLRVTERKLPELFGDPELRTQLQQDDTRG
CGRVDAILRNDVGDGFWASVAISRVTLSGRSKLLLVASDISEQRQLTELLSHQTSHDALT
ELYNRREFERRLHRALDATQDGAPLAVLLYIDLDQFKLINDTSGHLAGDQLLAQLAIVMR
RQLGGTDMLARLGGDEFGVLVTEVADRAEAERIAERMRRCIDGYVFIWEQRSYMVSASIG
GVTIDRPGILVKNLLAQADTACYMAKELGRNRVHFYSERDDQTVRRHSEMEWANRLRWAI
DEHRLVLTYQEIWPLPLVAGGELDVEVLLRFREESGQLVVPGVFMPAAERYGLMPVVDRW
VIETTLANFDRLHPAGSALRMVAINLSGASVEDEELAGRIIALLRRYRVEPSRVCFEITE
TVAVRDLSQVVRFMEQLRAVGCRIALDDFGAGMSSFTYLKNLPLDIIKIDGSFVRDMLTD
PVSHLMVRAVTDIGHRLGLEVVAEWVADAETVRALAALGVNRVQGFSLHRPEPALFQRD