Protein Info for LRK53_RS02425 in Rhodanobacter sp000427505 FW510-R12

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF01547: SBP_bac_1" amino acids 46 to 336 (291 residues), 152.6 bits, see alignment E=2.5e-48 PF13416: SBP_bac_8" amino acids 54 to 364 (311 residues), 132.6 bits, see alignment E=2.4e-42

Best Hits

KEGG orthology group: K10188, lactose/L-arabinose transport system substrate-binding protein (inferred from 56% identity to xal:XALc_1315)

Predicted SEED Role

"Sugar ABC transporter, periplasmic sugar-binding protein USSDB1B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>LRK53_RS02425 sugar ABC transporter substrate-binding protein (Rhodanobacter sp000427505 FW510-R12)
MKPGARAPRSWRGLWLAAIAAGGVLLGSCAPAPPGTQLTFWTIGREGEAIIKLLPAFERA
HPGIQVKVQQLPMTAAHQKLLTAFAGGSTPDLSQLGNTWLPELAALDALEPLQARVDHST
VIQPHDYFASIWATNVIDGTLYGVPWYVDTRLLFYRKDLLEAAGFDAPPRSWAEWRRQLA
ALSDPARHRYGILLPTNEYEQLMSLALQQSEPLLRDGDRYGNFESAGFKRALSFYVDTFR
LKQAPPISNVEAGNPWTEFGRGVYAFYLSGPWNIGEFRSRLPASQQGDWATAPLPGPDGA
GIGAAGGSSLVIFRTSKHKDAAWQLIEYLSQPAVQQRFYELLGDLPPRRSSWQGAALRED
PKLRAFREQLEHVKPTPPVPEWERIVNEMQLVAAEAVAGRLTIDQAAAEIDRRTDAILAK
RRWVLDHARGRAR