Protein Info for LRK53_RS02255 in Rhodanobacter sp000427505 FW510-R12

Annotation: 3-oxoacyl-ACP reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF01370: Epimerase" amino acids 10 to 96 (87 residues), 26 bits, see alignment E=1.2e-09 PF00106: adh_short" amino acids 10 to 198 (189 residues), 160.6 bits, see alignment E=6.6e-51 PF08659: KR" amino acids 11 to 182 (172 residues), 73.7 bits, see alignment E=3.8e-24 PF13561: adh_short_C2" amino acids 19 to 244 (226 residues), 169.8 bits, see alignment E=1.5e-53

Best Hits

Swiss-Prot: 41% identical to FABG_AGGAC: 3-oxoacyl-[acyl-carrier-protein] reductase FabG (fabG) from Aggregatibacter actinomycetemcomitans

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 75% identity to psu:Psesu_2788)

Predicted SEED Role

"3-oxoacyl-[ACP] reductase (EC 1.1.1.100)" (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>LRK53_RS02255 3-oxoacyl-ACP reductase FabG (Rhodanobacter sp000427505 FW510-R12)
MSEAPPARRALVTGGSGELGGAICHALAAAGWHVVVHGHHSLARAAETAAAIVAAGGSAQ
AVAFDVTDAEVVRAALDALLSEETIHALVNNAGIHDDAPMAGMSDAQWHRVIDVSLHGFF
HVTQPLLLPMARARFGRIVSIGSAAAQLGNRGQTNYAAAKAALVGASKSLSREMASRGIT
VNVVAPGVIEGRMAEATFPPERIRELVPAQRAGKPGEVAALVAFLCSDAAAYINGQVIGV
NGGMG