Protein Info for LRK53_RS01635 in Rhodanobacter sp000427505 FW510-R12

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00892: EamA" amino acids 9 to 135 (127 residues), 70.3 bits, see alignment E=1e-23 amino acids 149 to 281 (133 residues), 64.8 bits, see alignment E=5.2e-22

Best Hits

KEGG orthology group: None (inferred from 51% identity to mpt:Mpe_A2143)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>LRK53_RS01635 DMT family transporter (Rhodanobacter sp000427505 FW510-R12)
MKKIDYAVLLSLGALWGGSFLFMRMGAGAFGALPLAGLRAIGAALCFLPLLVSRARLAEW
RAHWWPIAVVGLTNSALPFVLFTFATRSLPAGVASIIDGMTPMFAALIGWLWLGQRLDVW
RGAGLAIGFAGVVWLAEGSLALGPGAGVALLACVAATVLYGFAVHYTHLRLGRVTPLVVT
VGSHMVAALLLLPTTLLAWPAQPPPLQAWLAAAGLAVLCTALAYVLFFWVLARVGATRIM
VIPYLIPAFGVLWGALLLGEPVSARLLGGCAVILLGTALTTGLVRTRRAAPALAPEEA