Protein Info for LRK53_RS01325 in Rhodanobacter sp000427505 FW510-R12

Annotation: magnesium-translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 884 transmembrane" amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 303 to 330 (28 residues), see Phobius details amino acids 690 to 708 (19 residues), see Phobius details amino acids 713 to 732 (20 residues), see Phobius details amino acids 753 to 775 (23 residues), see Phobius details amino acids 786 to 806 (21 residues), see Phobius details amino acids 818 to 841 (24 residues), see Phobius details amino acids 854 to 876 (23 residues), see Phobius details TIGR01524: magnesium-translocating P-type ATPase" amino acids 28 to 883 (856 residues), 1276 bits, see alignment E=0 PF00690: Cation_ATPase_N" amino acids 35 to 95 (61 residues), 49.9 bits, see alignment 5.9e-17 PF00122: E1-E2_ATPase" amino acids 141 to 259 (119 residues), 76.5 bits, see alignment E=3.8e-25 TIGR01494: HAD ATPase, P-type, family IC" amino acids 257 to 388 (132 residues), 66.8 bits, see alignment E=1.3e-22 amino acids 595 to 713 (119 residues), 106.6 bits, see alignment E=1.1e-34 PF00702: Hydrolase" amino acids 355 to 638 (284 residues), 57.5 bits, see alignment E=7.7e-19 PF13246: Cation_ATPase" amino acids 389 to 534 (146 residues), 80.1 bits, see alignment E=5.6e-26 PF00689: Cation_ATPase_C" amino acids 707 to 875 (169 residues), 70.1 bits, see alignment E=6.4e-23

Best Hits

Swiss-Prot: 55% identical to ATMA_ECOLI: Magnesium-transporting ATPase, P-type 1 (mgtA) from Escherichia coli (strain K12)

KEGG orthology group: K01531, Mg2+-importing ATPase [EC: 3.6.3.2] (inferred from 61% identity to pfl:PFL_3349)

Predicted SEED Role

"Mg(2+) transport ATPase, P-type (EC 3.6.3.2)" (EC 3.6.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (884 amino acids)

>LRK53_RS01325 magnesium-translocating P-type ATPase (Rhodanobacter sp000427505 FW510-R12)
MIKQSIQGALPKAPGKSAPAPAHVAAAQEAFRDNQALLAALDTTPAGLDEGQIAARLGRD
GVNEVSHEKPPHWSVQLLRAFKNPFIIVLLALAGVQLFTDSSDLTGPAIIAVMVGISVLL
SFTQEFRSSKAAEKLKAMVRNTVTVTRRASDGHSERIEVPVGELVAGDIVHLAAGDMVPA
DLRLLHAKDLFISQAILTGESLPVEKAAPDAPGVAGADHASPLDLPTICYMGTNVVSGTA
TAVVVATGPRSYLGSLAHSIVGQRVQTSFDRGVNSVSWLLIRFMAVMVPVVFLINGFDKH
DWLQAFMFALSVAVGLTPEMLPLIVTANLAKGALAMSGRKVVVKRLNAIQNFGAMDVLCT
DKTGTLTLDKIVLERHLDLHGEESDEALEYGYLNSRFQTGLKNLMDKAVLEHRDLEPAAA
HYRIVDEIPFDFQRRRMSVVLGNGDGHDLIVCKGAVEEMLSICAWARTGGEVVPMTDAQR
DEIKEMTHGLNEDGLRVLVVAVKQQPPAGRPYGVADESGLTAVGCLAFLDPPKDSAATAI
AALHHHGVQVKVITGDNEAVTRKICREVGLDVEHSAQGRQIEPLDDAALDALVARTTVFA
KMSPLQKARVVKSLQRQGHTVGFLGDGINDAPALREADVGISVDTATDIAKESADIILLE
KNLMVLEEGVIEGRITFGNIIKYIKMTASSNFGNMFSVLVASAFLPFLPMLPLQILVLNL
LYDISQLSIPFDRMDDEYLRKPRKWNASDIGRFMVWIGPVSSIFDITTFLLLWHVFGANS
VAHQSFFQSGWFVESLLTQTLIVHMIRTRRIPFLQSIASAPVLALTSAIILIGLFIPFIG
LGAKIGMVPLPPAFFGWVALTVLTYGVLTQLMKLVYIRRYGRWL