Protein Info for LRK53_RS01315 in Rhodanobacter sp000427505 FW510-R12
Annotation: heme o synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to CYOE_STRM5: Protoheme IX farnesyltransferase (cyoE) from Stenotrophomonas maltophilia (strain R551-3)
KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 77% identity to psu:Psesu_0183)MetaCyc: 36% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]
Predicted SEED Role
"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases
MetaCyc Pathways
- heme a biosynthesis (2/4 steps found)
KEGG Metabolic Maps
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Methionine metabolism
- Porphyrin and chlorophyll metabolism
- Riboflavin metabolism
- Terpenoid biosynthesis
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.-
Use Curated BLAST to search for 2.5.1.- or 2.5.1.141
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (300 amino acids)
>LRK53_RS01315 heme o synthase (Rhodanobacter sp000427505 FW510-R12) MSVFHEYLQLTKPRIVALLVFCAVIGMFLAVPGVPPWRVLVFGTLGIWLASSSAAAFNQL IDQRIDKVMVRTAHRPLATGHLNPRQVFVFALVLGIASMLVLVLWVNTLTAVLTFAGLIG YAVIYTAFLKRASPQNIVIGGLAGAIPPVLGWTAVTGALHPYALQLCLIIFVWTPPHFWA LAIFRRDDYSRAQVPMLPVTHGVVFTRWHILFYTVLLVLVTLLPALTGMSGLVYLGGAAV LGGAFLYYAVRLLNPPDELYAMRVFSYSIVYLMALFAFLLVDHWLLPPLMPSGPSSVSIG