Protein Info for LRK53_RS01275 in Rhodanobacter sp000427505 FW510-R12

Annotation: cytochrome c oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02790: COX2_TM
  • amino acids 30 to 110 (81 residues), 55.5 bits, E=5.2e-19
• TIGR02866: cytochrome c oxidase, subunit II
  • amino acids 54 to 275 (222 residues), 182.7 bits, E=3.1e-58
• PF00116: COX2
  • amino acids 127 to 263 (137 residues), 111.7 bits, E=2.1e-36

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Protein Sequence (303 amino acids)

>LRK53_RS01275 cytochrome c oxidase subunit II (Rhodanobacter sp000427505 FW510-R12)
MTSGGIRRSFTAVAALALASFGSAALAAPGPWQLNMERGASTWSPVPYHLNNVALGVCTV
IGVLVFSAMFIAIFRFRKSRGAVAEKWSHNTTVEVVWTTIPVLILITLAYLATSGLTSWA
DTTGSQMTVKVTGYQWKWRYDYVDYLGKSIDKVGFMSRLDTRSDQTRQLGSGMDPFAVKV
GNENTYLLDVDKPLVVPVDTKIRFVITSGDVIHSWWVPATGWKIDAIPGIINAAWANFTT
PGTYRGQCAELCGQDHGFMPIVVVVKSKADFAKWLAEQEASSAAPAAAAQTAQVAAPPAG
KQG