Protein Info for LRK53_RS01150 in Rhodanobacter sp000427505 FW510-R12

Annotation: glycoside hydrolase family 17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 324 to 342 (19 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 423 to 441 (19 residues), see Phobius details amino acids 447 to 466 (20 residues), see Phobius details amino acids 478 to 495 (18 residues), see Phobius details amino acids 501 to 521 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

"putative beta (1-6) glucans synthase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>LRK53_RS01150 glycoside hydrolase family 17 (Rhodanobacter sp000427505 FW510-R12)
MSPAASPVFRRAWPAWLALLLATLAGASWWWSVGRPVALPDAPSTRIACVSYAPFRLAGE
TPLDASAFISPERIDADLRALSQRFDCVRTYSQGQGLSAVPAIAERYGMKVLLGIWLSGD
AKANAQQIALGIATANKYPQVLRGVIVGNEVLLRGELTSAQLAGYLHQVRAAVGVPVTYA
DVWEFWLRHPELAGSVDYLTIHILPYWEDQPVPPECAVQHVATVYAKVQQAFPGRRVMIG
ETGWPSAGRPRQAASASVVNEARYLREFLRYAATVHMPYNVIEAFDQPWKRAQEGTAGGY
WGIFDAQARPKFAMQGPVTEEPHWWAGWLAGAAGAALFSLVGGWRRRWRGGRGWLALALA
GAASGGALAWQFRQMLYACRDGWEWALSLAAGALALLTALRLARWIAARLAGEAAPPAPP
RWLRAGWLFALAYYGLLLAVDGRYRDFPLGLFWLPCLGYALLGWLGERRAPGLPLLEERF
LAPGLPLLAVAVLLQEAGLTVVAWLWLGLNLLLAVPVLLDWQRARRLQPQQA