Protein Info for LRK53_RS00935 in Rhodanobacter sp000427505 FW510-R12

Annotation: monovalent cation/H(+) antiporter subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 17 to 105 (89 residues), 90.3 bits, see alignment E=3.9e-30 PF03334: PhaG_MnhG_YufB" amino acids 18 to 99 (82 residues), 75.8 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 55% identical to PHAG_RHIME: Probable K(+)/H(+) antiporter subunit G (phaG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05564, multicomponent K+:H+ antiporter subunit G (inferred from 60% identity to sno:Snov_2411)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (117 amino acids)

>LRK53_RS00935 monovalent cation/H(+) antiporter subunit G (Rhodanobacter sp000427505 FW510-R12)
MSHLDALPPWAAILVAVFVILGALFAFVGSLGLLRLKNFYQRVHAPTLGTTLGTFFMLAG
SITCFSVLHGRPIFYEILIGVFLTLTTPITLMLLVRAALYRDREEGSADVPQAQLHE