Protein Info for LRK53_RS00805 in Rhodanobacter sp000427505 FW510-R12

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF00356: LacI" amino acids 5 to 50 (46 residues), 61.6 bits, see alignment 7.1e-21 PF00532: Peripla_BP_1" amino acids 63 to 272 (210 residues), 87.3 bits, see alignment E=1.9e-28 PF13377: Peripla_BP_3" amino acids 174 to 339 (166 residues), 110.9 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 71% identity to xcc:XCC3412)

Predicted SEED Role

"Predicted transcriptional regulator of N-Acetylglucosamine utilization, LacI family" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (349 amino acids)

>LRK53_RS00805 LacI family DNA-binding transcriptional regulator (Rhodanobacter sp000427505 FW510-R12)
MRSATIKDVAERAGVSLKTVSRVINNEPSVHPRTRAKVQREIDALGYRPDPSARSLRSTR
AYAIGLVYDNPNAHYVINLQHGVLAACRASGYGLQIHPCDSSSPKLADELRELAQRSRLA
GLVLAPPMSEQPALIEALSQAQVPFIRIISARKDPQDGHPCVYVDDRDAAYAITEHLIQL
GHQRIGFLWGGREHHSSLERYQGYEDALKDYGIALDRKLIVPGDYTFDDGFRGARKLLAL
KERPSAIFGSNDEIAAGVLAAAHSDGINVPYELSIAGFEDSPFSKQSWPALTTARQATED
IARHAAQRLIGDLQRAANGEPPVSRNEGFSPELVVRGSTAPRHTVPSRR