Protein Info for LRK53_RS00695 in Rhodanobacter sp000427505 FW510-R12

Annotation: TonB-dependent vitamin B12 receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01779: TonB-dependent vitamin B12 receptor" amino acids 1 to 612 (612 residues), 617.9 bits, see alignment E=1.1e-189 PF07715: Plug" amino acids 43 to 148 (106 residues), 103.1 bits, see alignment E=1.1e-33 PF00593: TonB_dep_Rec_b-barrel" amino acids 233 to 587 (355 residues), 149.6 bits, see alignment E=2.6e-47

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 49% identity to sml:Smlt0585)

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (616 amino acids)

>LRK53_RS00695 TonB-dependent vitamin B12 receptor (Rhodanobacter sp000427505 FW510-R12)
MKKTLLTAALLGCTLAAHAADQNDASSLSPVIVTATRTAITADDALSSVTVITRADIERL
QPLSVPDLLAGLPGLSFANTGGYGEQTSLFMRGTNSTHTLLLVDGVRVASVSAGLAAFEQ
IPVEQIERIEVVRGPRSSLYGADAIGGVIQIFTRRGTPGGGLQPTFSVTTGSNHLLRGQA
GLAGGDEHAWYHLSVGAQYTRGINACRVGAAEAFAGCFADEPDRDAFRNRNLSAGGGYRW
DNGAELSGTWLRSLGEIHYDGSYQNRSRTVQQVAGSHLSFNPLQAWKTTLSVGQNLDRYD
NYENQAFVGYIYSRRNQASWQNDISVASNQLLTLGIDWQGEHIDSDTGFLANHRNDTGGY
AQYQGTFGRNEVELSARRDHNSQFGNHNTGAAAWGYHFDGGLKLSASYGSAFHAPTFNDL
YYPYGSGNPKLRPEKSRSAELGLSQQQDTWNWALNAYQTRIDQLIALDSNWVPRNVSKAR
IRGVEGQLGANLAGWQLQSYLTWLQPRNEDGGANDGKLLPRRREHTARVDLDRRFGAFGV
GATVFAAGRGFDDAANRHRLGGYSTTDLRASWHFAPDWQVEARLANVFDHRYETVWYFNQ
PGRGAFLTLRYSPAAR