Protein Info for LRK53_RS00630 in Rhodanobacter sp000427505 FW510-R12

Annotation: prolyl oligopeptidase family serine peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 813 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00930: DPPIV_N" amino acids 357 to 511 (155 residues), 45.8 bits, see alignment E=1.1e-15 PF20434: BD-FAE" amino acids 577 to 682 (106 residues), 31 bits, see alignment E=5.5e-11 PF02129: Peptidase_S15" amino acids 604 to 707 (104 residues), 32.1 bits, see alignment E=3e-11 PF00326: Peptidase_S9" amino acids 609 to 804 (196 residues), 147.1 bits, see alignment E=1.6e-46 PF01738: DLH" amino acids 610 to 794 (185 residues), 28.3 bits, see alignment E=3.8e-10

Best Hits

KEGG orthology group: None (inferred from 53% identity to xac:XAC4106)

Predicted SEED Role

"Dipeptidyl peptidase IV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (813 amino acids)

>LRK53_RS00630 prolyl oligopeptidase family serine peptidase (Rhodanobacter sp000427505 FW510-R12)
MRRLLLAALVAFIAAPAAAAPASTPLDLETVMANPDWIGQAVEQPYWSVDGRHVYYSMKR
DGSPLRDLYRVDPATGQSVKLDPTERAQADGPAVFDRAHRHAAFILHGDVFVVDLASGRR
RQVTRTPQDEVAPRFSVDGRALQYRTGNDWYSYDLASGVAAPAAILKFADDPQAKQPDAL
GRRQLELFKTLREIKADKQAARDEDKAQDAADPGRAPPPFYLGDKIAAVDTELSPDGRWM
LLVTVPRDYAKGEAPKVNHYVTESGYTEPQDARIYVGRNDPAPQSLLLLDLRGHQQYPLK
TDGLPGIKDDPLKALRAQAVTALEKAGKQDEAKALKAPDVRAVRIIAGTDDIGGGGIVWS
DDGGQLAIQLRAIDNKDRWIASVDFDRHALVPQHRLTDPAWINWNFNDFGWLKDGRTLWY
LSEETGWSQLYAKPLGGKPKALTTGRFEVSHPQLGEDGRWFYLRTNKVAPYSYDVYRVPS
AGGELARVTNYQGMDDFALSPDGTQLAVLHSAPYLFAQLAVQPSAGGTPRELTRTMKPAY
LAHDWIAPKIVEVPSSHGAGSIYAKYYGPANETDAPASRPAVIFVHGAGYLQNVKLSSTY
YFREQMFHNLLVSQGYVVLDMDYRASEGYGRAWRTAIYRQMGHPELEDLLDGKAWLVKNH
GVDPRRVGIYGGSYGGFMTEMALLRAPGEFAAGAGLRPVSDWTLYNHEYTSNILNDPQLD
PAAYRASSPIEYAEKLQDPLLIQHGLIDDNVFAEDSIRLYQRFIELHKKNFWMSLYPLER
HGFVHADSWYDEYRRIDELFGTYVKPVRDESRH