Protein Info for LRK53_RS00570 in Rhodanobacter sp000427505 FW510-R12

Annotation: nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR01818: nitrogen regulation protein NR(I)" amino acids 5 to 452 (448 residues), 604.9 bits, see alignment E=4.9e-186 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 80.1 bits, see alignment E=4.2e-26 PF00158: Sigma54_activat" amino acids 138 to 304 (167 residues), 227.5 bits, see alignment E=2.4e-71 PF14532: Sigma54_activ_2" amino acids 138 to 308 (171 residues), 73.9 bits, see alignment E=5e-24 PF07728: AAA_5" amino acids 160 to 278 (119 residues), 27.6 bits, see alignment E=7.8e-10 PF25601: AAA_lid_14" amino acids 309 to 385 (77 residues), 77.2 bits, see alignment E=2.1e-25 PF02954: HTH_8" amino acids 416 to 451 (36 residues), 37.4 bits, see alignment 5.1e-13

Best Hits

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 62% identity to sml:Smlt0159)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>LRK53_RS00570 nitrogen regulation protein NR(I) (Rhodanobacter sp000427505 FW510-R12)
MTDEIWILDDDRGVRFVLAEALRDAGLAVREFDAVAAVRAALREARPALLLTDVRMPGED
GLGLLGGLKAEGIGPVIVMSAYTDVATTAAAYRAGAVDYLAKPFDLDQAVAAVQRALASV
AGPAVPAGPALAPNHALLGESAPMREVFRLIGRVAASDLNVLVTGETGTGKELVARALHE
ESARRDKPFVALNTAAIPSELLESELFGHEAGAFTGATRRVAGRFEQAEGGTLFLDEIGD
MPLILQTRLLRVLAGGEFYRVGGRELIRCNVRIVAATHQDLAARVAAGAFRADLMHRLDV
VRIHLPALRERRNDIPLLARHFLAAAAQELKLPPKRYSKAALKLVAQRDYPGNVRELENL
CRRLAVIAPGSEILPTDLGSSAEAARGGEWTDALREWAAQALADGEADIHARARAALDQT
LLQAALQAHEGHRQNAAQALGVGRNTLTRKLGASRTRRG