Protein Info for LRK53_RS00545 in Rhodanobacter sp000427505 FW510-R12

Annotation: B12-binding domain-containing radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF04055: Radical_SAM" amino acids 215 to 374 (160 residues), 57.2 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K04034, anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase [EC: 4.-.-.-] (inferred from 69% identity to xcv:XCV1735)

Predicted SEED Role

"Radical SAM domain protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>LRK53_RS00545 B12-binding domain-containing radical SAM protein (Rhodanobacter sp000427505 FW510-R12)
MLRIHVGHCYFLRLDPKQWERGKPYPPLATIQVAALLRQMGHAVSLFDAMLADGVGDFED
SLRTTRPDLVVLYEDNFNFLTKMCLGRMREAACQMIAAARAGGARVIVAGSDASDHPDAF
LAAGAHAVLVGEGIAALAELVGRLQRDPAIGDDWAAGLGGVATLAGGQLRLTRLGALPPD
PRLVGHPAWDLVDIERYRALWHERHGYFSLNMAASRGCPFRCHWCAKPIWGNHYNQRRAE
DVAAEMSYLKRTFQPDHIWLADDIFGFRVDWVTAFAAHLHAADGPVPFTIQTRADLISER
MAAALGEAGCAEAWIGAESGSQRVLDAMNKGTHVADLVTARARLGEHGIRVSFFIQLGYL
GEQLADLLATRELIAQAAPDDIGVSVSYPLPGTKFYEQVKAQLGAKTHWQDSGDLAMMFR
GAYDSDFYRRVRDLLHEQVAIQQAQPAAPDQRHAALDAQWTALIASEGAHRNRNATSPPP
APARHVALPLY