Protein Info for LRK53_RS00475 in Rhodanobacter sp000427505 FW510-R12

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF01041: DegT_DnrJ_EryC1" amino acids 27 to 372 (346 residues), 374.7 bits, see alignment E=2.7e-116

Best Hits

Swiss-Prot: 52% identical to FDTB_ANETH: dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (fdtB) from Aneurinibacillus thermoaerophilus

KEGG orthology group: None (inferred from 74% identity to xoo:XOO2994)

MetaCyc: 52% identical to dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (Aneurinibacillus thermoaerophilus L420-91)
RXN-12811 [EC: 2.6.1.90]

Predicted SEED Role

"Aminotransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>LRK53_RS00475 DegT/DnrJ/EryC1/StrS family aminotransferase (Rhodanobacter sp000427505 FW510-R12)
MAGAVSEVALADVPFLDVGAINARHADELKAAVARVIDSGWYVMGAELAAFEREFAAWCG
VPHALGVGNGLDALALILRGYRQLGALREGDEVIVPGNTFIAGFLAVSANRLLPVPVEPD
PSSFNLDPACVEAAIGPRTRAIMAVHLYGQLADMPALAALAQRHRLLLIEDAAQAHGAAC
DGRRAGAFGDAAAFSFFPAKNLGALGDGGAVVTADAQLARQVAALRNYGSEVKYRHLWQG
VNSRLDEIQAAMLRVKLRHLDEDVARRRAVARRYRDGIRHAQIRLPQVTHEEGHAWHLFV
VRCARRDALQRHLLAHGIHSQVHYPVPPHRQPAYPELYQLRLPLTERLHDEVLSLPMDPT
LGDEAVQRVIDACQAFRCPP