Protein Info for LRK53_RS00445 in Rhodanobacter sp000427505 FW510-R12

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 26 to 178 (153 residues), 68.7 bits, see alignment E=2.3e-23 PF04542: Sigma70_r2" amino acids 30 to 94 (65 residues), 34.7 bits, see alignment E=2.4e-12 PF07638: Sigma70_ECF" amino acids 110 to 177 (68 residues), 21.7 bits, see alignment E=3.4e-08 PF08281: Sigma70_r4_2" amino acids 124 to 175 (52 residues), 44.8 bits, see alignment E=1.6e-15 PF04545: Sigma70_r4" amino acids 129 to 177 (49 residues), 39.5 bits, see alignment E=6.4e-14

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 71% identity to xal:XALc_1465)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (194 amino acids)

>LRK53_RS00445 sigma-70 family RNA polymerase sigma factor (Rhodanobacter sp000427505 FW510-R12)
MHDDELDSDVTDRMLLQRMSGGDRAALGILYRSYHGRLCRFLGRLTRRADVIEEVINDCF
WIAWQKAGSFHGDSRVSTWLMGIAYRSGLKTLRQYGDAPVEDDPRREERSAVHDLDEDRE
LRDWLSKGLDRLSADQRVVIELVYGVGHSLDEVAVIMQCPVGTVKARLFHARVKLRNVLP
SLAGEPPQHTEAMP