Protein Info for LRK53_RS00405 in Rhodanobacter sp000427505 FW510-R12

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details PF03458: Gly_transporter" amino acids 18 to 92 (75 residues), 70.9 bits, see alignment E=3.4e-24 amino acids 103 to 176 (74 residues), 81.3 bits, see alignment E=1.9e-27

Best Hits

Swiss-Prot: 45% identical to Y4104_STRCO: UPF0126 membrane protein SCO4104 (SCO4104) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: None (inferred from 65% identity to nha:Nham_3969)

Predicted SEED Role

"protein of unknown function UPF0126"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>LRK53_RS00405 trimeric intracellular cation channel family protein (Rhodanobacter sp000427505 FW510-R12)
MERPDEATRAMLHVLQLVLDLGGTFVFAISGAMVAVRHRLDIFGVLVLAFAAGNAGGITR
DLLIGAVPPAAIADLRYSGVSALAGLITFFWYPVTNRLRRDVLWLDAVGLAFFAVAGAQK
ALLHGIDPVMAALLGMVTGIGGGMLRDVLVSDIPAVLRADLYALAALAGAGVVVSAHLLH
LSPMVAALAGGGLCFVLRFMAIRHGWHLPTARPASAGASDAPQRRHHDEGS