Protein Info for LRK53_RS00395 in Rhodanobacter sp000427505 FW510-R12

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00106: adh_short" amino acids 4 to 186 (183 residues), 184.3 bits, see alignment E=3.6e-58 PF08659: KR" amino acids 5 to 160 (156 residues), 48.7 bits, see alignment E=1.8e-16 PF23441: SDR" amino acids 6 to 203 (198 residues), 40.4 bits, see alignment E=4.7e-14 PF13561: adh_short_C2" amino acids 11 to 246 (236 residues), 204 bits, see alignment E=5.4e-64

Best Hits

KEGG orthology group: None (inferred from 81% identity to gbm:Gbem_2147)

MetaCyc: 39% identical to 2-deoxy-D-ribonate dehydrogenase (Pseudomonas simiae)
1.1.1.M55 [EC: 1.1.1.M55]

Predicted SEED Role

"short chain dehydrogenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>LRK53_RS00395 SDR family oxidoreductase (Rhodanobacter sp000427505 FW510-R12)
MTQRVLVTAGASGIGKEIARAFVASGATVCVCDINVQALETAANDIPGLVTLVCDVSKRQ
DIERMVASAAEALGGLDVLVNNAGIAGPTAPVETADPDQWEAVMAVDVIGTFHVTRLAIP
YLKQSPAGSIVCMSSLGGRYGYPNRSAYCVAKMGLIGFTKTLSRELGQYGIRCNAIAPGA
VGGERMERVLQGRADADHTSLEEERQAMMSIQSIKRFVDPKDIASLIVFLASDAGKSISG
QVIPIDNDAQTSAL