Protein Info for LRK53_RS00050 in Rhodanobacter sp000427505 FW510-R12

Annotation: pyridoxine 5'-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF03740: PdxJ" amino acids 4 to 245 (242 residues), 261.1 bits, see alignment E=3.5e-82 TIGR00559: pyridoxine 5'-phosphate synthase" amino acids 4 to 246 (243 residues), 204.6 bits, see alignment E=9e-65

Best Hits

Swiss-Prot: 65% identical to PDXJ_XANC5: Pyridoxine 5'-phosphate synthase (pdxJ) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K03474, pyridoxine 5-phosphate synthase [EC: 2.6.99.2] (inferred from 66% identity to sml:Smlt0015)

Predicted SEED Role

"Pyridoxine 5'-phosphate synthase (EC 2.6.99.2)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.6.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>LRK53_RS00050 pyridoxine 5'-phosphate synthase (Rhodanobacter sp000427505 FW510-R12)
MTLLSVNLNKIAVLRNSRGGREPDICRAAQTCIESGCGGITVHPRPDLRHVRPDDVRALA
AMLRGRVEYNIEGNPFAAARGAYPGLVALAREVRPTQVTLVPDGDGQITSDHGFDLRRDL
AQLRPLVGELRELGCRVSLFVDAGSQDFELAAAIGAQRIEIYTGPYAEAFTEGQPAAALA
VCAETARRAQQAGLAVNAGHDLSQANLGTFKAAIPGLAEVSIGHALIGEALYEGLATTVR
NYLQILR