Protein Info for LRK53_RS00030 in Rhodanobacter sp000427505 FW510-R12

Annotation: energy transducer TonB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details PF28546: 1TM_TonB" amino acids 14 to 43 (30 residues), 49.6 bits, see alignment 2.6e-17 PF03544: TonB_C" amino acids 139 to 216 (78 residues), 86.6 bits, see alignment E=1.3e-28 TIGR01352: TonB family C-terminal domain" amino acids 140 to 217 (78 residues), 78.4 bits, see alignment E=2e-26

Best Hits

Swiss-Prot: 44% identical to TONB_XANCP: Protein TonB (tonB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 48% identity to xal:XALc_0008)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>LRK53_RS00030 energy transducer TonB (Rhodanobacter sp000427505 FW510-R12)
MASSNEEIGREPFSWKRTWALAVAIGLHAFAFLLIVAPMAPPNQNHKEKERIVQVNFIEP
PPPPPPPPPPPPEPPKQPPPKIIQQVKVPPTPPPPTPPPAVEEVSANATQAAPPAPPAPP
APPTDITASSDLSYNSRLQPKYPPQAIRQRHEGTVVLMILVGVDGSPKDIKIDRSSGYHE
LDRAAMDAARRWRFNPTIRNGQKVEGYARVPVNFNLNQL