Protein Info for LRK53_RS00015 in Rhodanobacter sp000427505 FW510-R12

Annotation: DNA replication/repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF13175: AAA_15" amino acids 1 to 43 (43 residues), 35.9 bits, see alignment 1.4e-12 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 338 (338 residues), 269.8 bits, see alignment E=1.9e-84 PF02463: SMC_N" amino acids 3 to 332 (330 residues), 71.7 bits, see alignment E=1.3e-23 PF13476: AAA_23" amino acids 5 to 42 (38 residues), 30.6 bits, see alignment 1.1e-10

Best Hits

Swiss-Prot: 50% identical to RECF_XANC8: DNA replication and repair protein RecF (recF) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 50% identity to xcc:XCC0003)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>LRK53_RS00015 DNA replication/repair protein RecF (Rhodanobacter sp000427505 FW510-R12)
MRLEQLRVRGLRCLTEVGVALDPGVNVFVGANGAGKTSVLEAAFLLSHARSFRSGAKEAL
LQRGATQLSIFAELRHADERVCRLGLGRDGVRWEAKLDGTGVALGQLVGECAVVCFEPGA
HGLIAGAAEERRRYLDWGVFHVEHAFLSTWRRYQRALKQRNSLLRAPAPPADELFAPWEA
ELAQAAEQIDRQRRSYLDRLRPKLLDGFAGLLPELGAFELRYRRGWSDELDLARQLREQR
GRDLARGHTTLGAHRADWSIMFEQAPLREHLSRGQEKLTALACLLAQAKLYAEQCGEWPI
VCLDDLASELDLAHQAAVVTLLLAADAQVLLTGTELPAALQGLPARVFHVEQGELTRLL