Protein Info for KEDOAH_26700 in Escherichia coli ECRC99

Name: ynbD
Annotation: Uncharacterized protein YnbD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 380 to 400 (21 residues), see Phobius details PF00782: DSPc" amino acids 314 to 437 (124 residues), 93.4 bits, see alignment E=5.3e-31

Best Hits

Swiss-Prot: 96% identical to YNBD_ECOLI: Uncharacterized protein YnbD (ynbD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ece:Z2316)

Predicted SEED Role

"Ser/Thr and Tyr protein phosphatase (dual specificity)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>KEDOAH_26700 Uncharacterized protein YnbD (Escherichia coli ECRC99)
VITERRNVLLQGAGWLLLLAPFFFFTYGSLNQFTAVQDFNSHDIPSQVFGWETAIPFLPW
TIVPYWSLDLLYGFSLFVCSSTFEQRRLVHRLILATVMACCGFFLYPLKFSFIRPEVSGV
TGWLFSQLELFDLPYNQSPSLHIVLCWLLWRHFRQHLAVRWRKVCGGWFLLIAISMLTTW
QHHFIDVITGLAVGMLIDWMIPVDRRWNYQKPDQRRIKIALPYVVGACACIVLMELMMMV
QLWWSVWLCWPVLSLLIIGRGYGGLGAITTGKDSQGKLPPAVYWLTLPWRIGMWLSMRWF
CRRLEPVSKMTAGVYLGAFPRHIPAQNAVLDVTFEFPRGRATKDRLYFCVPMLDLVVPEE
GELRQAVAMLETLREEQGSVLVHCALGLSRSALVVAAWLLCYGHCKTVDEAISFIRARRS
HIVLKEEHKAMLKLWENR